SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5K130 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5K130
Sequence length 101
Comment (sp|Q5K130|CLU1O_HUMAN) Putative chronic lymphocytic leukemia up-regulated protein 1 opposite strand transcript protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CLLU1OS; OC=Catarrhini; Hominidae; Homo.
Sequence
MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEI
SEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM
Download sequence
Identical sequences Q5K130
9606.ENSP00000367748 ENSP00000367748 gi|68563513|ref|NP_001020403.1| ENSP00000367748 ENSP00000367748 ENSP00000439051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]