SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5RKV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5RKV6
Domain Number 1 Region: 31-174
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-30
Family Ribonuclease PH domain 1-like 0.00000177
Further Details:      
 
Domain Number 2 Region: 176-266
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.99e-23
Family Ribonuclease PH domain 2-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5RKV6
Sequence length 272
Comment (sp|Q5RKV6|EXOS6_HUMAN) p11 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EXOSC6; OC=Catarrhini; Hominidae; Homo.
Sequence
MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGT
KVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEER
ELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLV
VGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEA
VRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP
Download sequence
Identical sequences Q5RKV6
2nn6_F 6d6q_F 6d6r_F gi|17402904|ref|NP_478126.1| 9606.ENSP00000398597 ENSP00000398597 ENSP00000398597 ENSP00000398597 NP_478126.1.87134 NP_478126.1.92137 2nn6F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]