SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5SSQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5SSQ6
Sequence length 148
Comment (sp|Q5SSQ6|SAPC1_HUMAN) Protein G7d KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SAPCD1; OC=Catarrhini; Hominidae; Homo.
Sequence
MGSQGSGGVPLVQAPYTVLLLPLGTSRQDPGAQSFFLWLRRMQALEREQDALWQGLELLQ
HGQAWFEDHLREAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKELS
RQQKGVTQPKEEMAQRGCTKGPRGPTRV
Download sequence
Identical sequences A0A2I2Y5N7 A0A2I3TKU7 Q5SSQ6
ENSP00000413372 ENSP00000446749 ENSP00000447344 ENSP00000448208 ENSP00000450257 ENSP00000450332 ENSP00000413372 ENSP00000446749 ENSP00000447344 ENSP00000448208 ENSP00000450257 ENSP00000450332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]