SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5T4W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5T4W7
Domain Number 1 Region: 121-218
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.29e-17
Family Transforming growth factor (TGF)-beta 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5T4W7
Sequence length 220
Comment (sp|Q5T4W7|ARTN_HUMAN) Neublastin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARTN; OC=Catarrhini; Hominidae; Homo.
Sequence
MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLAS
PAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGA
RGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGS
RPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Download sequence
Identical sequences Q5T4W7
gi|209954781|ref|NP_476432.2| ENSP00000361429 ENSP00000361434 ENSP00000361429 ENSP00000361434 NP_476432.2.87134 NP_476432.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]