SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5T4W7 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5T4W7
Domain Number 1 Region: 121-218
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.29e-17
Family Transforming growth factor (TGF)-beta 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
extracellular space 1.3 58.12
cell surface 1.3 28.92
cytoplasmic vesicle part 1.417 16.2
microvillus 2.247 11.4
secretory vesicle 1.539 9.96
Golgi lumen 2.224 9.72
endoplasmic reticulum lumen 1.891 8.85
vesicle lumen 2.247 6.11
axon 1.501 6
main axon 2.037 6
Molecular Function IC (bits) H-Score
cytokine receptor binding 1.974 113.42
G-protein coupled receptor binding 1.912 58.74
cytokine binding 1.952 40.49
growth factor binding 1.592 38.62
antigen binding 2.239 37.23
enzyme activator activity 1.431 30.27
amide binding 1.538 23.87
heparin binding 1.414 16.5
fibronectin binding 2.165 15.33
protein serine/threonine kinase activity 1.514 13.1

Protein sequence

External link(s) Q5T4W7
Sequence length 220
Comment (sp|Q5T4W7|ARTN_HUMAN) Neublastin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARTN; OC=Catarrhini; Hominidae; Homo.
Sequence
MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLAS
PAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGA
RGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGS
RPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Download sequence
Identical sequences Q5T4W7
ENSP00000361429 ENSP00000361434 ENSP00000361429 ENSP00000361434 gi|209954781|ref|NP_476432.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]