SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5VWI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5VWI1
Domain Number 1 Region: 447-508
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000497
Family FF domain 0.0000643
Further Details:      
 
Domain Number 2 Region: 508-568
Classification Level Classification E-value
Superfamily FF domain 0.0000000000406
Family FF domain 0.0046
Further Details:      
 
Domain Number 3 Region: 335-372
Classification Level Classification E-value
Superfamily WW domain 0.000000538
Family WW domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5VWI1
Sequence length 586
Comment (sp|Q5VWI1|TCRGL_HUMAN) Transcription elongation regulator 1-like protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TCERG1L; OC=Catarrhini; Hominidae; Homo.
Sequence
MQAGARFQRRRRQLQQQQPRRRQPLLWPMDAEPPPPPPWVWMVPGSAGLLRLSAGVVVPP
VLLASAPPPAAPLLPGLPGWPAPSEPVLPLLPLPSAPDSAAAAAAHPFPALHGQWLFGGH
SPSLGLPPSSTVELVPVFPHLCPSALATPIGKSWIDKRIPNCKIFFNNSFALDSTWIHPE
ESRFFHGHEKPRLLANQVAVSLSRPAPASRPLPTVVLAPQPIPGGCHNSLKVTSSPAIAI
ATAAAAAMVSVDPENLRGPSPSSVQPRHFLTLAPIKIPLRTSPVSDTRTERGRVARPPAL
MLRAQKSRDGDKEDKEPPPMLGGGEDSTARGNRPVASTPVPGSPWCVVWTGDDRVFFFNP
TMHLSVWEKPMDLKDRGDLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNR
TEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIV
FDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKE
FAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDKENRLRLRKMR
Download sequence
Identical sequences Q5VWI1
ENSP00000357631 ENSP00000357631 gi|148727264|ref|NP_777597.2| 9606.ENSP00000357631 NP_777597.2.87134 NP_777597.2.92137 ENSP00000357631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]