SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5VYX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5VYX0
Domain Number 1 Region: 4-164,269-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-19
Family FAD-linked reductases, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5VYX0
Sequence length 342
Comment (sp|Q5VYX0|RNLS_HUMAN) Monoamine oxidase-C KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RNLS; OC=Catarrhini; Hominidae; Homo.
Sequence
MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGA
QYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLK
ESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISEC
QRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGP
SLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC
PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
Download sequence
Identical sequences Q5VYX0
ENSP00000361015 ENSP00000332530 NP_001026879.2.87134 NP_001026879.2.92137 9606.ENSP00000332530 gi|237649117|ref|NP_001026879.2| ENSP00000332530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]