SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5VZB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5VZB9
Domain Number 1 Region: 92-139
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 5.62e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 325-368
Classification Level Classification E-value
Superfamily UBA-like 0.00000074
Family CUE domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5VZB9
Sequence length 504
Comment (sp|Q5VZB9|DMRTA_HUMAN) Doublesex- and mab-3-related transcription factor A1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DMRTA1; OC=Catarrhini; Hominidae; Homo.
Sequence
MERSQCGSRDRGVSGRPHLAPGLVVAAPPPPSPALPVPSGMQVPPAFLRPPSLFLRAAAA
AAAAAAATSGSGGCPPAPGLESGVGAVGCGYPRTPKCARCRNHGVVSALKGHKRFCRWRD
CACAKCTLIAERQRVMAAQVALRRQQAQEESEARGLQRLLCSGLSWPPGGRASGGGGRAE
NPQSTGGPAAGAALGLGALRQASGSATPAFEVFQQDYPEEKQEQKESKCESCQNGQEELI
SKSHQLYLGSSSRSNGVIGKQSIGSSISEYSNKPDSILSPHPGEQSGGEESPRSLSSSDL
ESGNESEWVKDLTATKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCKGDVVQAI
EQVLNGKEHKPDNRNLANSEELENTAFQRASSFSLAGIGFGTLGNKSAFSPLQTTSASYG
GDSSLYGVNPRVGISPLRLAYSSAGRGLSGFMSPYLTPGLVPTLPFRPALDYAFSGMIRD
SSYLSSKDSITCGRLYFRPNQDNP
Download sequence
Identical sequences Q5VZB9
ENSP00000319651 ENSP00000319651 ENSP00000319651 gi|170763515|ref|NP_071443.2| 9606.ENSP00000319651 NP_071443.2.87134 NP_071443.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]