SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5XKK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5XKK7
Sequence length 198
Comment (sp|Q5XKK7|F219B_HUMAN) Protein FAM219B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAM219B; OC=Catarrhini; Hominidae; Homo.
Sequence
MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYM
VTRAPSIQAKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENL
VSLDSDSDGELGSRYSSGYSSAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASS
TCSCCWCCLGDSSSCTLQ
Download sequence
Identical sequences Q5XKK7
ENSP00000350260 ENSP00000454719 NP_001308849.1.87134 NP_001308849.1.92137 NP_001308850.1.87134 NP_001308850.1.92137 NP_065180.1.87134 NP_065180.1.92137 ENSP00000350260 ENSP00000454719 ENSP00000350260 9606.ENSP00000350260 gi|33457346|ref|NP_065180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]