SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q63HK5 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q63HK5
Domain Number - Region: 894-961
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000115
Family Homeodomain 0.019
Further Details:      
 
Domain Number - Region: 1030-1063
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00154
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 273-297,381-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00208
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 209-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0548
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q63HK5
Sequence length 1081
Comment (sp|Q63HK5|TSH3_HUMAN) Zinc finger protein 537 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TSHZ3; OC=Catarrhini; Hominidae; Homo.
Sequence
MPRRKQQAPRRAAAYVSEELKAAALVDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQ
NSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLEDTTVSDSLEQMKA
VYNNFLSNSYWSNLNLNLHQPSSEKNNGSSSSSSSSSSSCGSGSFDWHQSAMAKTLQQVS
QSRMLPEPSLFSTVQLYRQSSKLYGSIFTGASKFRCKDCSAAYDTLVELTVHMNETGHYR
DDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHY
QKVPLKEPVTPVAAKIIPATRKKASLELELPSSPDSTGGTPKATISDTNDALQKNSNPYI
TPNNRYGHQNGASYAWHFEARKSQILKCMECGSSHDTLQELTAHMMVTGHFIKVTNSAMK
KGKPIVETPVTPTITTLLDEKVQSVPLAATTFTSPSNTPASISPKLNVEVKKEVDKEKAV
TDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEESPKGGLDILKSLENTVTSAINKAQNG
TPSWGGYPSIHAAYQLPNMMKLSLGSSGKSTPLKPMFGNSEIVSPTKNQTLVSPPSSQTS
PMPKTNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASS
DGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHPPEQPFVN
PLSALQSVMNIHLGKAAKPSLPALDPMSMLFKMSNSLAEKAAVATPPPLQSKKADHLDRY
FYHVNNDQPIDLTKGKSDKGCSLGSVLLSPTSTAPATSSSTVTTAKTSAVVSFMSNSPLR
ENALSDISDMLKNLTESHTSKSSTPSSISEKSDIDGATLEEAEESTPAQKRKGRQSNWNP
QHLLILQAQFAASLRQTSEGKYIMSDLSPQERMHISRFTGLSMTTISHWLANVKYQLRRT
GGTKFLKNLDTGHPVFFCNDCASQIRTPSTYISHLESHLGFRLRDLSKLSTEQINSQIAQ
TKSPSEKMVTSSPEEDLGTSYQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLLYVSELEK
Q
Download sequence
Identical sequences Q63HK5
ENSP00000240587 9606.ENSP00000240587 gi|127138957|ref|NP_065907.2| ENSP00000240587 ENSP00000240587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]