SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6NUN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6NUN0
Domain Number 1 Region: 30-578
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.68e-143
Family Acetyl-CoA synthetase-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6NUN0
Sequence length 579
Comment (sp|Q6NUN0|ACSM5_HUMAN) Acyl-CoA synthetase medium-chain family member 5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ACSM5; OC=Catarrhini; Hominidae; Homo.
Sequence
MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVL
DVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMML
VLPRLPEWWLVSVACMRTGTVMIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAIS
AECPSLQTKLLVSDSSRPGWLNFRELLREASTEHNCMRTKSRDPLAIYFTSGTTGAPKMV
EHSQSSYGLGFVASGRRWVALTESDIFWNTTDTGWVKAAWTLFSAWPNGSCIFVHELPRV
DAKVILNTLSKFPITTLCCVPTIFRLLVQEDLTRYQFQSLRHCLTGGEALNPDVREKWKH
QTGVELYEGYGQSETVVICANPKGMKIKSGSMGKASPPYDVQIVDDEGNVLPPGEEGNVA
VRIRPTRPFCFFNCYLDNPEKTAASEQGDFYITGDRARMDKDGYFWFMGRNDDVINSSSY
RIGPVEVESALAEHPAVLESAVVSSPDPIRGEVVKAFIVLTPAYSSHDPEALTRELQEHV
KRVTAPYKYPRKVAFVSELPKTVSGKIQRSKLRSQEWGK
Download sequence
Identical sequences Q6NUN0
gi|38505220|ref|NP_060358.2| ENSP00000327916 9606.ENSP00000327916 NP_001311300.1.87134 NP_001311300.1.92137 NP_060358.2.87134 NP_060358.2.92137 ENSP00000327916 ENSP00000327916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]