SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6P1R4 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6P1R4
Domain Number 1 Region: 18-299
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.52e-73
Family FMN-linked oxidoreductases 0.00022
Further Details:      
 
Weak hits

Sequence:  Q6P1R4
Domain Number - Region: 384-434
Classification Level Classification E-value
Superfamily RING/U-box 0.0424
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microbody 1.856 14.18
plastid 1.525 4.19

Protein sequence

External link(s) Q6P1R4
Sequence length 473
Comment (sp|Q6P1R4|DUS1L_HUMAN) tRNA-dihydrouridine synthase 1-like KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DUS1L; OC=Catarrhini; Hominidae; Homo.
Sequence
MPKLQGFEFWSRTLRGARHVVAPMVDQSELAWRLLSRRHGAQLCYTPMLHAQVFVRDANY
RKENLYCEVCPEDRPLIVQFCANDPEVFVQAALLAQDYCDAIDLNLGCPQMIAKRGHYGA
FLQDEWDLLQRMILLAHEKLSVPVTCKIRVFPEIDKTVRYAQMLEKAGCQLLTVHGRTKE
QKGPLSGAASWEHIKAVRKAVAIPVFANGNIQCLQDVERCLRDTGVQGVMSAEGNLHNPA
LFEGRSPAVWELAEEYLDIVREHPCPLSYVRAHLFKLWHHTLQVHQELREELAKVKTLEG
IAAVSQELKLRCQEEISRQEGAKPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEE
EEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVFSLCRGCCKKRAS
KETADCPGHGLLFKTKLEKSLAWKEAQPELQEPQPAAPGTPGGFSEVMGSALA
Download sequence
Identical sequences Q6P1R4
ENSP00000303515 ENSP00000346280 gi|40807366|ref|NP_071439.3| ENSP00000303515 ENSP00000303515 ENSP00000346280 9606.ENSP00000303515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]