SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6P587 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6P587
Domain Number 1 Region: 19-220
Classification Level Classification E-value
Superfamily FAH 2.75e-74
Family FAH 0.00000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6P587
Sequence length 224
Comment (sp|Q6P587|FAHD1_HUMAN) YisK-like protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAHD1; OC=Catarrhini; Hominidae; Homo.
Sequence
MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPIL
MPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWT
LAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKII
TLEEGDIILTGTPKGVGPVKENDEIEAGIHGLVSMTFKVEKPEY
Download sequence
Identical sequences Q6P587
NP_112485.1.87134 NP_112485.1.92137 gi|13654274|ref|NP_112485.1| ENSP00000398053 Hs13654274___KOG1535 ENSP00000398053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]