SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6PG37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6PG37
Domain Number 1 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.16e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 528-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000882
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 337-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000013
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 150-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000341
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 574-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000292
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  Q6PG37
Domain Number - Region: 198-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00411
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6PG37
Sequence length 636
Comment (sp|Q6PG37|ZN790_HUMAN) Zinc finger protein 790 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF790; OC=Catarrhini; Hominidae; Homo.
Sequence
MAHLMMFRDVAVDFSQEEWECLDLEQRDLYRDVMLENYSNMVSLGFCIYQPEAFSLLEKG
KEPWKILRDETRGPCPDMQSRCQTKKLLPKNGIFEREIAQLEIMRICKNHSLDCLCFRGD
WEGNTQFQTLQDNQEECFKQVIRTCEKRPTFNQHTVFNLHQRLNTGDKLNEFKELGKAFI
SGSDHTQHQLIHTSEKFCGDKECGNTFLPDSEVIQYQTVHTVKKTYECKECGKSFSLRSS
LTGHKRIHTGEKPFKCKDCGKAFRFHSQLSVHKRIHTGEKSYECKECGKAFSCGSDLTRH
QRIHTGEKPYECNECRKAFSQRSHLIKHQRIHTGEKPYECKECGKAFTRGSHLTQHQRIH
TGEKSHECKECGKAFIRGSNLAQHQNVHVGRKPYKCEKCGKAYIWSSHLARHQRIHTGRK
PYECKQCGKTFTWASYLAQHEKIHNERKSYECKECGKTFLHGSEFNRHQKIHTGERNYEC
KECGKTFFRGSELNRHQKIHTGKRPYECEECGKAFLWGSQLTRHQRMHTGEEPYVCKECG
KSFIWGSQLTRHKKIHTDAEPYGCKKSSHIFSHHSYFTEQKIHNSANLCEWTDYGNTFSH
ESNFAQHQNIYTFEKSYEFKDFEKAFSSSSHFISLL
Download sequence
Identical sequences Q6PG37
NP_001229729.1.87134 NP_001229729.1.92137 NP_001229730.1.87134 NP_001229730.1.92137 NP_001229731.1.87134 NP_001229731.1.92137 NP_996777.2.87134 NP_996777.2.92137 XP_005258960.1.92137 XP_011525252.1.92137 ENSP00000349161 9606.ENSP00000349161 ENSP00000349161 ENSP00000478852 ENSP00000480764 ENSP00000480834 gi|125346192|ref|NP_996777.2| gi|338797722|ref|NP_001229729.1| gi|338797724|ref|NP_001229730.1| gi|338797726|ref|NP_001229731.1| ENSP00000349161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]