SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6PGP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6PGP7
Domain Number 1 Region: 390-632
Classification Level Classification E-value
Superfamily HCP-like 1.39e-32
Family HCP-like 0.0067
Further Details:      
 
Domain Number 2 Region: 565-661,774-902
Classification Level Classification E-value
Superfamily HCP-like 1.75e-24
Family HCP-like 0.018
Further Details:      
 
Domain Number 3 Region: 805-1114
Classification Level Classification E-value
Superfamily TPR-like 3.8e-16
Family Tetratricopeptide repeat (TPR) 0.0057
Further Details:      
 
Domain Number 4 Region: 263-411
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000422
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 5 Region: 17-91
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000194
Family Tetratricopeptide repeat (TPR) 0.005
Further Details:      
 
Domain Number 6 Region: 1055-1196,1253-1281
Classification Level Classification E-value
Superfamily TPR-like 0.00000000114
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 7 Region: 1336-1452
Classification Level Classification E-value
Superfamily TPR-like 0.0000000717
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6PGP7
Sequence length 1564
Comment (sp|Q6PGP7|TTC37_HUMAN) Tricho-hepatic-enteric syndrome protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TTC37; OC=Catarrhini; Hominidae; Homo.
Sequence
MSSKEVKTALKSARDAIRNKEYKEALKHCKTVLKQEKNNYNAWVFIGVAAAELEQPDQAQ
SAYKKAAELEPDQLLAWQGLANLYEKYNHINAKDDLPGVYQKLLDLYESVDKQKWCDVCK
KLVDLYYQEKKHLEVARTWHKLIKTRQEQGAENEELHQLWRKLTQFLAESTEDQNNETQQ
LLFTAFENALGLSDKIPSEDHQVLYRHFIQSLSKFPHESARLKKACEGMINIYPTVQYPL
EVLCLHLIESGNLTDEGQQYCCRLVEMDSKSGPGLIGLGIKALQDKKYEDAVRNLTEGLK
ESPVCTSGWYHLAEAQVKMHRPKEAVLSCSQALKIVDNLGASGNSLYQRNLCLHLKAEAL
IKLSDYDSSEEAIRTLDQISDADNIPGLLVLKSLAYRNKGSFDEAAKIMEDLLSSYPDLA
EVHALEALIHFTKKDYLQAEKCFQRALEKDTEVAEYHYQLGLTYWFMGEETRKDKTKALT
HFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVE
LEDMEMALAILTTVTQKASAGTAKWAWLRRGLYYLKAGQHSQAVADLQAALRADPKDFNC
WESLGEAYLSRGGYTTALKSFTKASELNPESIYSVFKVAAIQQILGKYKEAVAQYQMIIK
KKEDYVPALKGLGECHLMMAKAALVDYLDGKAVDYIEKALEYFTCALQHRADVSCLWKLA
GDACTCLYAVAPSKVNVHVLGVLLGQKEGKQVLKKNELLHLGGRCYGRALKLMSTSNTWC
DLGINYYRQAQHLAETGSNMNDLKELLEKSLHCLKKAVRLDSNNHLYWNALGVVACYSGI
GNYALAQHCFIKSIQSEQINAVAWTNLGVLYLTNENIEQAHEAFKMAQSLDPSYLMCWIG
QALIAEAVGSYDTMDLFRHTTELNMHTEGALGYAYWVCTTLQDKSNRETELYQYNILQMN
AIPAAQVILNKYVERIQNYAPAFTMLGYLNEHLQLKKEAANAYQRAILLLQTAEDQDTYN
VAIRNYGRLLCSTGEYDKAIQAFKSTPLEVLEDIIGFALALFMKGLYKESSKAYERALSI
VESEQDKAHILTALAITEYKQGKTDVAKTLLFKCSILKEPTTESLQALCALGLAMQDATL
SKAALNELLKHIKHKDSNYQRCLLTSAIYALQGRSVAVQKQISKAVHSNPGDPALWSLLS
RVVAQYAQRNAKGGVVAGNVAHILDSNHGKKALLYTAVNQLAMGSSSAEDEKNTALKTIQ
KAALLSPGDPAIWAGLMAACHADDKLALVNNTQPKRIDLYLALLSAVSASIKDEKFFENY
NQSLEKWSLSQAVTGLIDTGRISEAETLCTKNLKSNPDQPAVILLLRQVQCKPLLESQKP
LPDAVLEELQKTVMSNSTSVPAWQWLAHVYQSQGMMRAAEMCYRKSLQLASQRGSWSGKL
SSLLRLALLALKVCMANISNDHWPSLVQEATTEALKLCFCPLAVLLQALLQFKRKMGARE
TRRLLERVVYQPGYPKSIASTARWYLLRHLYAKDDYELIDVLVNNAKTHGDTRALELNQR
LSSQ
Download sequence
Identical sequences Q6PGP7
ENSP00000351596 ENSP00000351596 9606.ENSP00000351596 ENSP00000351596 NP_055454.1.87134 NP_055454.1.92137 gi|7662078|ref|NP_055454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]