SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6PP77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6PP77
Sequence length 449
Comment (sp|Q6PP77|XKR2_HUMAN) X Kell blood group-related, X-linked KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=XKRX; OC=Catarrhini; Hominidae; Homo.
Sequence
MDRVYEIPEEPNVDPVSSLEEDVIRGANPRFTFPFSILFSTFLYCGEAASALYMVRIYRK
NSETYWMTYTFSFFMFSSIMVQLTLIFVHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKY
LTLWKKEEQEEPYVSLTRKKMLIDGEEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGS
VPQLTYQLYVSLISAEVPLGRVVLMVFSLVSVTYGATLCNMLAIQIKYDDYKIRLGPLEV
LCITIWRTLEITSRLLILVLFSATLKLKAVPFLVLNFLIILFEPWIKFWRSGAQMPNNIE
KNFSRVGTLVVLISVTILYAGINFSCWSALQLRLADRDLVDKGQNWGHMGLHYSVRLVEN
VIMVLVFKFFGVKVLLNYCHSLIALQLIIAYLISIGFMLLFFQYLHPLRSLFTHNVVDYL
HCVCCHQHPRTRVENSEPPFETEARQSVV
Download sequence
Identical sequences A0A2J8K143 G3QG78 Q6PP77
NP_997724.2.87134 NP_997724.2.92137 ENSP00000362047 gi|237874249|ref|NP_997724.2| ENSP00000362047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]