SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6U736 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6U736
Domain Number 1 Region: 29-313
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.29e-59
Family Rhodopsin-like 0.0000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6U736
Sequence length 354
Comment (sp|Q6U736|OPN5_HUMAN) Transmembrane protein 13 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OPN5; OC=Catarrhini; Hominidae; Homo.
Sequence
MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSR
RKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGS
LITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFG
TSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRI
HSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM
YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE
Download sequence
Identical sequences Q6U736
ENSP00000360255 NP_859528.1.87134 NP_859528.1.92137 ENSP00000360255 gi|38678524|ref|NP_859528.1| 9606.ENSP00000244799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]