SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6UWN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6UWN8
Domain Number 1 Region: 28-80
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.88e-16
Family Ovomucoid domain III-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6UWN8
Sequence length 80
Comment (sp|Q6UWN8|ISK6_HUMAN) Kallikrein inhibitor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SPINK6; OC=Catarrhini; Hominidae; Homo.
Sequence
MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCA
FCKAIVKSGGKISLKHPGKC
Download sequence
Identical sequences Q6UWN8
ENSP00000324870 ENSP00000481309 9606.ENSP00000324870 ENSP00000324870 gi|305632839|ref|NP_001182219.1| gi|68299793|ref|NP_995313.2| ENSP00000421119 NP_001182219.1.87134 NP_001182219.1.92137 NP_995313.2.87134 NP_995313.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]