SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6UXN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6UXN8
Domain Number 1 Region: 91-236
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-33
Family C-type lectin domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6UXN8
Sequence length 241
Comment (sp|Q6UXN8|CLC9A_HUMAN) C-type lectin domain family 9 member A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CLEC9A; OC=Catarrhini; Hominidae; Homo.
Sequence
MHEEEIYTSLQWDSPAPDTYQKCLSSNKCSGACCLVMVISCVFCMGLLTASIFLGVKLLQ
VSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCPNNWIQN
RESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQD
GHSGRWLWQDGSSPSPGLLPAERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSS
V
Download sequence
Identical sequences Q6UXN8
9606.ENSP00000348074 ENSP00000348074 gi|46409326|ref|NP_997228.1| ENSP00000348074 NP_997228.1.87134 NP_997228.1.92137 ENSP00000348074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]