SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6ZN66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6ZN66
Domain Number 1 Region: 283-581
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 6.15e-111
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.000000281
Further Details:      
 
Domain Number 2 Region: 10-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-72
Family G proteins 0.0000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6ZN66
Sequence length 633
Comment (sp|Q6ZN66|GBP6_HUMAN) Guanine nucleotide-binding protein 6 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GBP6; OC=Catarrhini; Hominidae; Homo.
Sequence
MESGPKMLAPVCLVENNNEQLLVNQQAIQILEKISQPVVVVAIVGLYRTGKSYLMNHLAG
QNHGFPLGSTVQSETKGIWMWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAV
LLCSTFVYNSMSTINHQALEQLHYVTELTELIKAKSSPRPDGVEDSTEFVSFFPDFLWTV
RDFTLELKLNGHPITEDEYLENALKLIQGNNPRVQTSNFPRECIRRFFPKRKCFVFDRPT
NDKDLLANIEKVSEKQLDPKFQEQTNIFCSYIFTHARTKTLREGITVTGNRLGTLAVTYV
EAINSGAVPCLENAVITLAQRENSAAVQRAADYYSQQMAQRVKLPTDTLQELLDMHAACE
REAIAIFMEHSFKDENQEFQKKFMETTMNKKGDFLLQNEESSVQYCQAKLNELSKGLMES
ISAGSFSVPGGHKLYMETKERIEQDYWQVPRKGVKAKEVFQRFLESQMVIEESILQSDKA
LTDREKAVAVDRAKKEAAEKEQELLKQKLQEQQQQMEAQDKSRKENIAQLKEKLQMEREH
LLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNL
ADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF
Download sequence
Identical sequences Q6ZN66
ENSP00000359485 ENSP00000359485 gi|157671915|ref|NP_940862.2| NP_940862.2.87134 NP_940862.2.92137 XP_011539137.1.92137 9606.ENSP00000359485 ENSP00000359485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]