SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6ZYL4 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6ZYL4
Domain Number 1 Region: 6-70
Classification Level Classification E-value
Superfamily TFB5-like 1.96e-25
Family TFB5-like 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.369 17.67
DNA-directed RNA polymerase II, holoenzyme 2.009 17.67
nuclear transcription factor complex 2.016 6.6
transferase complex 1.369 6.55
Biological Process IC (bits) H-Score
protein-DNA complex subunit organization 2.045 15.91
DNA repair 1.506 13.66
RNA biosynthetic process 1.544 11.59
nucleotide-excision repair 2.227 4.25
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6ZYL4
Sequence length 71
Comment (sp|Q6ZYL4|TF2H5_HUMAN) TFIIH basal transcription factor complex TTD-A subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GTF2H5; OC=Catarrhini; Hominidae; Homo.
Sequence
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL
MDQNAFSLTQK
Download sequence
Identical sequences A0A096MQZ5 A0A0D9RKN5 A0A0P6IXV2 A0A1A6FVT2 A0A1S3FUE0 A0A1U7Q6R1 D3ZEI7 E2RRJ1 F2Z5A9 F7FPD2 F7HBD9 G1LSJ9 G1RIW0 G1U5T7 G3HFX4 G3RTK3 G7P4W3 H2PKQ7 H2QTY8 I3M2B7 M3X5Q7 Q2T9Z5 Q6ZYL4 U6CQ88 W5P2J8
ENSPANP00000002181 ENSP00000476100 ENSGGOP00000019128 ENSAMEP00000010039 gi|46359855|ref|NP_997001.1| ENSSTOP00000003099 ENSCJAP00000006606 ENSBTAP00000011263 IGBMC-0079-000 ENSSSCP00000019949 ENSDNOP00000020262 5ivw.1 5iy6.1 5iy7.1 5iy8.1 5iy9.1 d2jnja1 d2jnjb1 ENSCJAP00000006606 ENSPPYP00000019185 ENSOCUP00000024773 ENSOPRP00000008885 ENSOARP00000004648 ENSGGOP00000019128 ENSOCUP00000024773 ENSCAFP00000036445 ENSPPYP00000019185 ENSOPRP00000008885 ENSP00000476100 ENSMMUP00000033293 ENSNLEP00000013166 10116.ENSRNOP00000024211 9544.ENSMMUP00000033293 9598.ENSPTRP00000031987 9600.ENSPPYP00000019185 9606.ENSP00000356067 9615.ENSCAFP00000033024 9685.ENSFCAP00000010087 9823.ENSSSCP00000004387 9823.ENSSSCP00000013104 9913.ENSBTAP00000011263 9986.ENSOCUP00000024773 ENSBTAP00000011263 ENSFCAP00000010087 ENSPTRP00000031987 ENSCAFP00000036445 ENSP00000415032 ENSVPAP00000004791 ENSSSCP00000019949 ENSMMUP00000033293 ENSRNOP00000024211 ENSNLEP00000013166 ENSVPAP00000004791 ENSAMEP00000010039 ENSPVAP00000005800 ENSFCAP00000021958 ENSSTOP00000003099 ENSRNOP00000024211 ENSPVAP00000005800 ENSPTRP00000031987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]