SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q6ZYL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6ZYL4
Domain Number 1 Region: 6-70
Classification Level Classification E-value
Superfamily TFB5-like 1.96e-25
Family TFB5-like 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6ZYL4
Sequence length 71
Comment (sp|Q6ZYL4|TF2H5_HUMAN) TFIIH basal transcription factor complex TTD-A subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GTF2H5; OC=Catarrhini; Hominidae; Homo.
Sequence
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL
MDQNAFSLTQK
Download sequence
Identical sequences A0A0D9RKN5 A0A0P6IXV2 A0A1A6FVT2 A0A1S3FUE0 A0A1U7Q6R1 A0A2I3GP70 A0A2I3LYQ9 A0A2K5DU83 A0A2K5JFA4 A0A2K5P2E5 A0A2K5RC98 A0A2K5YQA0 A0A2K6CS36 A0A2K6MVT0 A0A2K6QN51 A0A2K6TYU9 D3ZEI7 E2RRJ1 F2Z5A9 F7FPD2 F7HBD9 G1LSJ9 G1U5T7 G3HFX4 G3RTK3 G7P4W3 H2PKQ7 H2QTY8 Q2T9Z5 Q6ZYL4 U6CQ88 W5P2J8
ENSRNOP00000024211 ENSPTRP00000031987 ENSPVAP00000005800 ENSMMUP00000033293 ENSCAFP00000036445 ENSAMEP00000010039 ENSPANP00000002181 IGBMC-0079-000 ENSGGOP00000019128 ENSVPAP00000004791 ENSMMUP00000033293 ENSOCUP00000024773 ENSBTAP00000011263 5ivw.1 5iy6.1 5iy7.1 5iy8.1 5iy9.1 NP_001035627.1.59421 NP_001035627.1.76553 NP_001119560.1.100692 NP_001119560.1.4139 NP_001177898.1.72884 NP_997001.1.87134 NP_997001.1.92137 XP_001145020.1.37143 XP_002915161.1.58354 XP_003271794.1.23891 XP_003480269.1.46622 XP_003502861.1.69978 XP_003805845.1.60992 XP_003986722.1.62641 XP_004044930.1.27298 XP_004440767.1.5094 XP_004473276.1.11602 XP_004595509.1.84141 XP_004674010.1.23501 XP_005065975.1.91757 XP_005321458.1.77405 XP_005321459.1.77405 XP_005363455.1.66349 XP_005390586.1.28644 XP_005390587.1.28644 XP_005552263.1.63531 XP_005615600.1.84170 XP_005872950.1.60319 XP_005900441.1.15283 XP_005977728.1.78601 XP_006075768.1.26621 XP_006093944.1.53796 XP_006227956.1.100692 XP_006739138.1.47382 XP_006757750.1.95426 XP_006932176.1.62641 XP_006932177.1.62641 XP_007097285.1.5354 XP_007097286.1.5354 XP_007097287.1.5354 XP_007617296.1.28591 XP_008152889.1.99482 XP_008261956.1.1745 XP_008541587.1.77740 XP_008585244.1.73410 XP_008585245.1.73410 XP_008686739.1.72690 XP_008837737.1.79516 XP_010839181.1.44457 XP_010977418.1.51371 XP_012306944.1.9421 XP_012416551.1.74151 XP_012423715.1.74151 XP_012579456.1.23501 XP_012579458.1.23501 XP_012785341.1.84141 XP_012785342.1.84141 XP_012785343.1.84141 XP_012785344.1.84141 XP_012879995.1.60039 XP_012900417.1.14098 XP_012932138.1.39548 XP_012982392.1.91757 XP_013372849.1.28644 XP_013822084.1.57651 XP_014400554.1.60319 XP_014409973.1.101512 XP_014650974.1.5094 XP_014702434.1.49734 XP_014936353.1.86478 XP_014936354.1.86478 XP_014936355.1.86478 XP_014992536.1.72884 XP_015354128.1.40921 XP_015354129.1.40921 XP_015354130.1.40921 XP_015354131.1.40921 XP_016018397.1.101085 XP_016018398.1.101085 XP_016018399.1.101085 XP_016018400.1.101085 XP_016056178.1.3490 XP_016056179.1.3490 XP_017394031.1.71028 XP_017745150.1.44346 XP_017827004.1.60252 XP_017827005.1.60252 XP_019268226.1.44245 XP_019268227.1.44245 XP_019268228.1.44245 XP_019604965.1.88060 XP_019604974.1.88060 XP_019650669.1.58354 XP_019823203.1.53367 XP_020942078.1.46622 XP_021077285.1.100879 XP_021077286.1.100879 XP_021491375.1.76796 XP_021491376.1.76796 XP_021549109.1.83697 XP_021579612.1.77405 XP_855012.1.84170 ENSDNOP00000020262 ENSP00000415032 ENSGGOP00000019128 ENSFCAP00000010087 ENSSSCP00000019949 ENSP00000476100 ENSCJAP00000006606 ENSCAFP00000036445 ENSCJAP00000006606 gi|46359855|ref|NP_997001.1| ENSNLEP00000013166 ENSFCAP00000021958 ENSP00000476100 ENSBTAP00000011263 ENSPVAP00000005800 ENSOPRP00000008885 ENSOPRP00000008885 d2jnja1 d2jnjb1 ENSPTRP00000031987 ENSSTOP00000003099 ENSOCUP00000024773 ENSSSCP00000019949 ENSNLEP00000013166 ENSPPYP00000019185 10116.ENSRNOP00000024211 9544.ENSMMUP00000033293 9598.ENSPTRP00000031987 9600.ENSPPYP00000019185 9606.ENSP00000356067 9615.ENSCAFP00000033024 9685.ENSFCAP00000010087 9823.ENSSSCP00000004387 9823.ENSSSCP00000013104 9913.ENSBTAP00000011263 9986.ENSOCUP00000024773 ENSSTOP00000003099 ENSRNOP00000024211 ENSPPYP00000019185 ENSAMEP00000010039 ENSOARP00000004648 ENSVPAP00000004791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]