SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q70HW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q70HW3
Domain Number 1 Region: 4-260
Classification Level Classification E-value
Superfamily Mitochondrial carrier 9.15e-63
Family Mitochondrial carrier 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q70HW3
Sequence length 274
Comment (sp|Q70HW3|SAMC_HUMAN) Solute carrier family 25 member 26 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SLC25A26; OC=Catarrhini; Hominidae; Homo.
Sequence
MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGS
FPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSA
STRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSW
QSAVCGAFAGGFAAAVTTPLDVAKTRITLAKAGSSTADGNVLSVLHGVWRSQGLAGLFAG
VFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP
Download sequence
Identical sequences Q70HW3
NP_775742.4.87134 NP_775742.4.92137 ENSP00000336801 ENSP00000456306 9606.ENSP00000336801 gi|258645120|ref|NP_775742.4| ENSP00000346955 ENSP00000346955 ENSP00000456546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]