SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q70YC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q70YC5
Domain Number - Region: 207-291
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q70YC5
Sequence length 407
Comment (sp|Q70YC5|ZN365_HUMAN) Protein su48 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF365; OC=Catarrhini; Hominidae; Homo.
Sequence
MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLT
KCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAE
RPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRI
DKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESE
EELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGF
VRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPA
KAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII
Download sequence
Identical sequences Q70YC5
ENSP00000378674 NP_055766.2.87134 NP_055766.2.92137 gi|148596972|ref|NP_055766.2| ENSP00000378674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]