SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7L1I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7L1I2
Domain Number 1 Region: 94-324,361-417
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-48
Family LacY-like proton/sugar symporter 0.064
Further Details:      
 
Domain Number 2 Region: 537-679
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-20
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 
Domain Number 3 Region: 442-520
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000811
Family Pentapeptide repeats 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7L1I2
Sequence length 683
Comment (sp|Q7L1I2|SV2B_HUMAN) Synaptic vesicle glycoprotein 2B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SV2B; OC=Catarrhini; Hominidae; Homo.
Sequence
MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVK
AKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALM
ADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSM
SLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLG
IFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPCTVSMVALKFMPES
PRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPKQMDEFIEIQSSTGTWY
QRWLVRFKTIFKQVWDNALYCVMGPYRMNTLILAVVWFAMAFSYYGLTVWFPDMIRYFQD
EEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFE
DVTSTDTYFKNCTIESTIFYNTDLYEHKFINCRFINSTFLEQKEGCHMDLEQDNDFLIYL
VSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFC
GTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLA
AASLVGGGLIALRLPETREQVLM
Download sequence
Identical sequences Q7L1I2
NP_001309960.1.87134 NP_001309960.1.92137 NP_001309961.1.87134 NP_001309961.1.92137 NP_001309966.1.87134 NP_001309966.1.92137 NP_001309967.1.87134 NP_001309967.1.92137 NP_001309968.1.87134 NP_001309968.1.92137 NP_055663.1.87134 NP_055663.1.92137 XP_005255055.1.92137 XP_016878250.1.92137 XP_016878251.1.92137 ENSP00000332818 ENSP00000377779 ENSP00000450992 gi|7662270|ref|NP_055663.1| ENSP00000332818 ENSP00000377779 ENSP00000450992 9606.ENSP00000332818 1675S ENSP00000332818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]