SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7L804 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7L804
Domain Number 1 Region: 15-158
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.59e-28
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 2 Region: 469-501
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.00000000000327
Family Eferin C-derminal domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7L804
Sequence length 512
Comment (sp|Q7L804|RFIP2_HUMAN) NRip11 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAB11FIP2; OC=Catarrhini; Hominidae; Homo.
Sequence
MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVW
KEEASFELPGLLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
RLESKQGKRIKNRGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTF
SDTSSAIIPSTHMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEK
LKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMNQPDSIVDEGELCFGRQ
NDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENKREKREKVSLF
ERVTGKKDSRRSDKLNNGGSDSPCDLKSPNAFSENRQDYFDYESTNPFTAKFRASNIMPS
SSFHMSPTSNEDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDY
IDNLLVRVMEETPSILRVPYEPSRKAGKFSNS
Download sequence
Identical sequences Q7L804
ENSP00000347839 gi|7662394|ref|NP_055719.1| ENSP00000347839 NP_055719.1.87134 NP_055719.1.92137 9606.ENSP00000347839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]