SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7RTV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7RTV2
Domain Number 1 Region: 80-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.11e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000416
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.62e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7RTV2
Sequence length 222
Comment (sp|Q7RTV2|GSTA5_HUMAN) Glutathione S-transferase A5-5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GSTA5; OC=Catarrhini; Hominidae; Homo.
Sequence
MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAK
TALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF
Download sequence
Identical sequences Q7RTV2
ENSP00000284562 ENSP00000360028 gi|24308514|ref|NP_714543.1| 9606.ENSP00000284562 ENSP00000284562 ENSP00000360028 ENSP00000284562 NP_714543.1.87134 NP_714543.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]