SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7Z407 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Z407
Domain Number 1 Region: 1587-1695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 889-1003
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-33
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 241-343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 4 Region: 1938-2047
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 715-834
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-32
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 6 Region: 2110-2218
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 7 Region: 2276-2395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 8 Region: 65-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1407-1523
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-28
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 10 Region: 548-658
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2464-2568
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1067-1176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 1240-1349
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 1755-1870
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 15 Region: 3171-3242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.99e-21
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 16 Region: 2816-2879
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.29e-18
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 17 Region: 3055-3123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-18
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 18 Region: 2873-2941
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.91e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2931-3004
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.05e-18
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 20 Region: 3112-3182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 3231-3300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.36e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 2757-2826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 23 Region: 485-556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 2223-2292
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000189
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 25 Region: 2630-2697
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 26 Region: 3351-3419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000347
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 2987-3048
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000459
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 28 Region: 3290-3346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000598
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 29 Region: 2568-2641
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 2051-2113
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000391
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 1527-1591
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000432
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 1009-1069
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000737
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 33 Region: 1700-1765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000001
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 34 Region: 663-722
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 35 Region: 1877-1943
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 36 Region: 1182-1244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000405
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 37 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000513
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 38 Region: 1353-1415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000133
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 39 Region: 3410-3468
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 40 Region: 2704-2768
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000417
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 41 Region: 834-902
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000162
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 42 Region: 2394-2457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000702
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7Z407
Sequence length 3707
Comment (sp|Q7Z407|CSMD3_HUMAN) CUB and sushi multiple domains protein 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CSMD3; OC=Catarrhini; Hominidae; Homo.
Sequence
MKGIRKGESRAKESKPWEPGKRRCAKCGRLDFILMKKMGIKSGFTFWNLVFLLTVSCVKG
FIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYDYLS
LYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSSCGN
PGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIANSVNTASWDFPVPICRAEDA
CGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQGSSTLTHTTSTGELEEH
NRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPA
DTQSTRRRPRHAEQIERTKELAVVTHRVKKAIDFKSRGFKLFPGKDNSNKFSILNEGGIK
TASNLCPDPGEPENGKRIGSDFSLGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWSDHR
PVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTNKVIQINFEEFDLEIGY
DTLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLHLQTDESVGSVGFKVNYKEIE
KESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVCQENNQWSANIPICIFP
CLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFNDFDLESQFDFLAVKDG
DSPESPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNITYNTFGHNECPDPGIP
INARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMWSGLIPKCGAPCGGHFS
APSGVILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTELNYDVLEVHDGPNLLSP
LLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHYESVTVNTYSCLDPGIPVHGR
RYGHDFSIGSTVSFSCDSGYRLSHEEPLLCEKNHWWSHPLPTCDALCGGDVRGPSGTILS
PGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLEDHHDYLLITENGSFTQPLARLTGSD
LPPTINAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCEDPGIPQYGSRIGFNFGI
GDTLTFSCSSGYRLEGTSEIICLGGGRRVWSAPLPRCVAECGASATNNEGILLSPNYPLN
YENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTTHLLGAFTGASMRGLTL
SSTSNQLWLEFNSDTEGTDEGFQLVYTSFELSHCEDPGIPQFGYKISDQGHFAGSTIIYG
CNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNNLR
CMWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPENDMLLKEISGSLIPEGIHSTLNI
VTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNGTRNGDGREPGDTVVFQCDPGYEL
QGEERITCIQVENRYFWQPSPPVCIAPCGGNLTGSSGFILSPNFPHPYPHSRDCDWTITV
NADYVISLAFISFSIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPERIESSSNTMHLAFRS
DGSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLGSTVTYYCDAGYVLQGYSTLT
CIMGDDGRPGWNRALPSCHAPCGSRSTGSEGTVLSPNYPKNYSVGHNCVYSIAVPKEFVV
FGQFVFFQTSLHDVVEVYDGPTQQSSLLSSLSGSHSGESLPLSSGNQITIRFTSVGPITA
KGFHFVYQAVPRTSSTQCSSVPEPRFGRRIGNEFAVGSSVLFDCNPGYILHGSIAIRCET
VPNSLAQWNDSLPTCIVPCGGILTKRKGTILSPGYPEPYDNNLNCVWKITVPEGAGIQVQ
VVSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNSTSNNLYLNFQSDISVSAAGF
HLEYTAIGLDSCPEPQTPSSGIKIGDRYMVGDVVSFQCDQGYSLQGHSHITCMPGPVRRW
NYPIPICLAQCGGAMSDFSGVILSPGFPGNYPSSLDCTWTINLPIGFGVHLQFVNFSTET
IHDYLEVRSGSSETSTVIGRLSGPQIPSSLFSTTHETSLYFHSDYSQNKQGFHIVYQAYQ
LQSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLIGNSALTCLHGVSRNWNHPLPRCE
ALCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVRVPPGNGIYINFTVLQTEPIYDFITVW
DGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFVLSYHAYQLRVCQPPPP
VPNAEILTEDDEFEIGDIIRYQCLPGFTLVGNAILTCRLGERLQMDGAPPVCQVLCPANE
LRLDSTGVILSPGYPDSYPNLQMCAWSISVEKGYNITMFVEFFQTEKEFDVLQVYDGPNI
QSPVLISLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGFRIRYIAFYCSTPESPPHGYI
ISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHAWDAPVPACQAISCGIPKAPTN
GGILTTDYLVGTRVTYFCNDGYRLSSKELTTAVCQSDGTWSNHNKTPRCVVVTCPSINSF
ILEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLPNGTWSWRNERPYCQIISCG
ELPTPPNGNKIGTQTSYGSTAIFTCDLGFMLVGSAVRECLSSGLWSESETRCLAGHCGIP
ELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVPVSCGHPGS
PIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPMCKVVNCSDPGIPA
NSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGQWDKPLPECIMIDCGHPGV
PPNAVLSGEKYTFGSTVHYSCTGKRSLLGQSSRTCQLNGHWSGSQPHCSGDATGTCGDPG
TPGHGSRQESNFRTKSTVRYACDTGYILHGSEERTCLANGSWTGRQPECKAVQCGNPGTT
ANGKVFRIDGTTFSSSVIYSCMEGYILSGPSVRQCTANGTWSGTLPNCTIISCGDPGIPA
NGLRYGDDYVVGQNVSYMCQPGYTMELNGSRIRTCTINGTWSGVMPTCRAVTCPTPPQIS
NGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSGEVPQCLPKFCGDPGIPAQG
KREGKSFIYQSEVSFSCNFPFILVGSSTRICQADGTWSGSSPHCIEPTQTSCENPGVPRH
GSQNNTFGFQVGSVVQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECIPHSCKQPETPAHA
NVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPICEAGSKILVKDPRPA
LGTPSPKLSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTSFNASTGRVNATLSNSNMELL
LSGVYKSQEARLMLRIYLIKVPAHASVKKMKEENWAMDGFVSAEPDGATYVFQGFIQGKD
YGQFGLQRLGLNMSEGSNSSNQPHGTNSSSVAIAILVPFFALIFAGFGFYLYKQRTAPKT
QYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences Q7Z407
gi|38045888|ref|NP_937756.1| ENSP00000297405 9606.ENSP00000297405 ENSP00000297405 NP_937756.1.87134 NP_937756.1.92137 ENSP00000297405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]