SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7Z7E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Z7E8
Domain Number 1 Region: 249-408
Classification Level Classification E-value
Superfamily UBC-like 1.88e-32
Family UBC-related 0.000000199
Further Details:      
 
Domain Number 2 Region: 42-155
Classification Level Classification E-value
Superfamily UBC-like 0.0000167
Family UBC-related 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7Z7E8
Sequence length 422
Comment (sp|Q7Z7E8|UB2Q1_HUMAN) Ubiquitin-protein ligase Q1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=UBE2Q1; OC=Catarrhini; Hominidae; Homo.
Sequence
MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFR
IASACLDELSCEFLLAGAGGAGAGAAPGPHLPPRGSVPGDPVRIHCNITESYPAVPPIWS
VESDDPNLAAVLERLVDIKKGNTLLLQHLKRIISDLCKLYNLPQHPDVEMLDQPLPAEQC
TQEDVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQD
YLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALH
NDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGW
SSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKE
DG
Download sequence
Identical sequences A0A096N3H9 A0A0D9S5D7 A0A2K5MI72 E1BIE5 H2N5K7 H2Q055 Q7Z7E8
ENSP00000292211 ENSPPYP00000000906 9598.ENSPTRP00000002337 9600.ENSPPYP00000000906 9606.ENSP00000292211 9913.ENSBTAP00000009889 ENSSSCP00000006976 ENSTTRP00000013274 ENSPANP00000006893 NP_001193249.1.59421 NP_001193249.1.76553 NP_060052.3.87134 NP_060052.3.92137 XP_001152268.1.37143 XP_002810147.1.23681 XP_004284702.1.21590 XP_005677490.3.57651 XP_007975167.1.81039 XP_011932103.1.92194 XP_011987664.1.54773 ENSTTRP00000013274 ENSPPYP00000000906 ENSSSCP00000006976 ENSP00000292211 ENSP00000292211 ENSPTRP00000002337 ENSBTAP00000009889 ENSBTAP00000009889 gi|31543906|ref|NP_060052.3| ENSPTRP00000002337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]