SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q86SF2 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86SF2
Domain Number 1 Region: 186-520
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.24e-55
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 525-654
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.16e-31
Family Ricin B-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Q86SF2
Sequence length 657
Comment (sp|Q86SF2|GALT7_HUMAN) UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GALNT7; OC=Catarrhini; Hominidae; Homo.
Sequence
MRLKIGFILRSLLVVGSFLGLVVLWSSLTPRPDDPSPLSRMREDRDVNDPMPNRGGNGLA
PGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTF
TYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKQAIQASIKEFGFNMVAS
DMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLA
EIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYL
DAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIPQGGGDEDGYARGAWDWSM
LWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEIS
YKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDYF
YASRPESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPPKNVDWGEIRGF
ETAYCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHC
NLNEFKEWQYFKNLHRFTHIPSGKCLDRSEVLHQVFISNCDSSKTTQKWEMNNIHSV
Download sequence
Identical sequences Q86SF2
gi|157502212|ref|NP_059119.2| ENSP00000265000 9606.ENSP00000265000 ENSP00000265000 ENSP00000265000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]