SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q86XP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q86XP6
Sequence length 184
Comment (sp|Q86XP6|GKN2_HUMAN) Trefoil factor interactions(z) 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GKN2; OC=Catarrhini; Hominidae; Homo.
Sequence
MKILVAFLVVLTIFGIQSHGYEVFNIISPSNNGGNVQETVTIDNEKNTAIINIHAGSCSS
TTIFDYKHGYIASRVLSRRACFILKMDHQNIPPLNNLQWYIYEKQALDNMFSSKYTWVKY
NPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENTHNVGAGGCAKAGLLGILGISICA
DIHV
Download sequence
Identical sequences Q86XP6
gi|59858535|ref|NP_872342.2| ENSP00000329292 ENSP00000329292 NYSGRC-59858535 ENSP00000329292 NP_872342.2.87134 NP_872342.2.92137 9606.ENSP00000329292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]