SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8IVW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IVW1
Domain Number 1 Region: 14-87
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.31e-18
Family G proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8IVW1
Sequence length 177
Comment (sp|Q8IVW1|ARL17_HUMAN) ADP-ribosylation factor 7 variant KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARL17B; OC=Catarrhini; Hominidae; Homo.
Sequence
MGNIFEKLFKSLLGKKKMRILILSLDTAGKTTILYKLKLGETVPAVPTVGFCVETVEYKN
NTFAVWDVGSHFKIRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGR
SHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKDLSSGFPSFLTSSILWKSAVVK
Download sequence
Identical sequences A8K0M5 Q8IVW1
NP_001034172.3.87134 NP_001034172.3.92137 NP_001107210.1.87134 NP_001107210.1.92137 gi|166063999|ref|NP_001107210.1| 9606.ENSP00000337478 9606.ENSP00000381306 9606.ENSP00000404247 ENSP00000337478 ENSP00000404247 ENSP00000449219 ENSP00000337478 ENSP00000404247 ENSP00000481838 ENSP00000483271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]