SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8IWV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IWV2
Domain Number 1 Region: 595-801
Classification Level Classification E-value
Superfamily Fibronectin type III 1.9e-31
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 2 Region: 803-988
Classification Level Classification E-value
Superfamily Fibronectin type III 1.84e-27
Family Fibronectin type III 0.0000219
Further Details:      
 
Domain Number 3 Region: 416-502
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 315-403
Classification Level Classification E-value
Superfamily Immunoglobulin 2.04e-20
Family I set domains 0.00073
Further Details:      
 
Domain Number 5 Region: 224-310
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-20
Family I set domains 0.0026
Further Details:      
 
Domain Number 6 Region: 497-601
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-17
Family I set domains 0.05
Further Details:      
 
Domain Number 7 Region: 24-116
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-17
Family I set domains 0.00036
Further Details:      
 
Domain Number 8 Region: 124-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000577
Family I set domains 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8IWV2
Sequence length 1026
Comment (sp|Q8IWV2|CNTN4_HUMAN) Brain-derived immunoglobulin superfamily protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CNTN4; OC=Catarrhini; Hominidae; Homo.
Sequence
MRLPWELLVLQSFILCLADDSTLHGPIFIQEPSPVMFPLDSEEKKVKLNCEVKGNPKPHI
RWKLNGTDVDTGMDFRYSVVEGSLLINNPNKTQDAGTYQCTATNSFGTIVSREAKLQFAY
LDNFKTRTRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLY
IAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPTAKG
ATVKLECFALGNPVPTIIWRRADGKPIARKARRHKSNGILEIPNFQQEDAGLYECVAENS
RGKNVARGQLTFYAQPNWIQKINDIHVAMEENVFWECKANGRPKPTYKWLKNGEPLLTRD
RIQIEQGTLNITIVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRVTLVK
VGGEVVIECKPKASPKPVYTWKKGRDILKENERITISEDGNLRIINVTKSDAGSYTCIAT
NHFGTASSTGNLVVKDPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLI
DFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPP
EAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVSTVPELIDGKTFTAT
VVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITW
ETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVF
NNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKY
WRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPP
PSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVEL
SLPFDEDYIIEIKPFSDGGDGSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISL
TARSSL
Download sequence
Identical sequences A0A024R2E5 Q8IWV2
NYSGRC-IgSF-CNTN4_HUMAN NP_001193884.1.87134 NP_001193884.1.92137 NP_783200.1.87134 NP_783200.1.92137 XP_011531727.1.92137 XP_011531728.1.92137 XP_011531729.1.92137 XP_011531730.1.92137 XP_011531731.1.92137 XP_011531732.1.92137 XP_016861271.1.92137 XP_016861272.1.92137 XP_016861273.1.92137 ENSP00000390560 gi|28373122|ref|NP_783200.1| gi|332688245|ref|NP_001193884.1| 9606.ENSP00000380602 ENSP00000380602 ENSP00000396010 ENSP00000413642 ENSP00000380602 ENSP00000396010 ENSP00000413642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]