SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8IY84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IY84
Domain Number 1 Region: 71-366
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-84
Family Protein kinases, catalytic subunit 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8IY84
Sequence length 436
Comment (sp|Q8IY84|NIM1_HUMAN) NIM1 serine/threonine-protein kinase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NIM1K; OC=Catarrhini; Hominidae; Homo.
Sequence
MTAVYMNGGGLVNPHYARWDRRDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEK
VVREITLGKRIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSR
EISSMEKLHHPNIIRLYEVVETLSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQI
VSAVKHMHENQIIHRDLKAENVFYTSNTCVKVGDFGFSTVSKKGEMLNTFCGSPPYAAPE
LFRDEHYIGIYVDIWALGVLLYFMVTGTMPFRAETVAKLKKSILEGTYSVPPHVSEPCHR
LIRGVLQQIPTERYGIDCIMNDEWMQGVPYPTPLEPFQLDPKHLSETSTLKEEENEVKST
LEHLGITEEHIRNNQGRDARSSITGVYRIILHRVQRKKALESVPVMMLPDPKERDLKKGS
RVYRGIRHTSKFCSIL
Download sequence
Identical sequences Q8IY84
ENSP00000313572 ENSP00000313572 ENSP00000420849 ENSP00000313572 ENSP00000420849 gi|23503303|ref|NP_699192.1| NP_699192.1.87134 NP_699192.1.92137 XP_006714513.1.92137 9606.ENSP00000313572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]