SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8IZ13 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IZ13
Domain Number 1 Region: 213-560
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000243
Family Hermes transposase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.369 37.1
replication fork 2.213 25.79
cytoplasmic ribonucleoprotein granule 1.929 17.93
intracellular ribonucleoprotein complex 1.368 13.61
small nuclear ribonucleoprotein complex 1.97 11.75
exosome (RNase complex) 2.182 11.2
DNA repair complex 2.125 9.29
protein-DNA complex 1.923 9.21
chromosomal part 1.512 5.84
host cell part 1.996 5.65

Protein sequence

External link(s) Q8IZ13
Sequence length 594
Comment (sp|Q8IZ13|ZBED8_HUMAN) Zinc finger BED domain-containing protein 8 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZBED8; OC=Catarrhini; Hominidae; Homo.
Sequence
MSKKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAG
HDLNSLKHMPAPSDQSETLKAFGVASHEDTLLQASYQFAYLCAKEKNPHTVAEKLVKPCA
LEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETT
DMDDCSQLMAFVRYIKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFFLKHKIALDVCGSV
CTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVIKTLPTKLRDALFTVVRVINF
IKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEINQFLHHKSSN
LVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIE
KRNFTNFPFLEEIIVSDNEGIFIAAEITLHLQQLSNFFHGYFSIGDLNEASKWILDPFLF
NIDFVDDSYLMKNDLAELRASGQILMEFETMKLEDFWCAQFTAFPNLAKTALEILMPFAT
TYLCELGFSSLLHFKTKSRSCFNLSDDIRVAISKKVPRFSDIIEQKLQLQQKSL
Download sequence
Identical sequences Q8IZ13
9606.ENSP00000386184 gi|28916698|ref|NP_071373.2| NYSGRC-28916698 ENSP00000386184 ENSP00000386184 ENSP00000428831 ENSP00000386184 ENSP00000428831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]