SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8IZU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IZU9
Domain Number 1 Region: 146-250
Classification Level Classification E-value
Superfamily Immunoglobulin 7.26e-19
Family I set domains 0.064
Further Details:      
 
Domain Number 2 Region: 334-422
Classification Level Classification E-value
Superfamily Immunoglobulin 8.03e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 418-514
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000688
Family I set domains 0.032
Further Details:      
 
Domain Number 4 Region: 50-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000722
Family I set domains 0.048
Further Details:      
 
Domain Number 5 Region: 246-331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000143
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8IZU9
Sequence length 778
Comment (sp|Q8IZU9|KIRR3_HUMAN) Processed kin of IRRE-like protein 3 {ECO:0000250|UniProtKB:Q8BR86} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=UNQ5923/PRO4502/PRO19814 OC=Catarrhini; Hominidae; Homo.
Sequence
MKPFQLDLLFVCFFLFSQELGLQKRGCCLVLGYMAKDKFRRMNEGQVYSFSQQPQDQVVV
SGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKILRAELQ
DDAVYECQAIQAAIRSRPARLTVLVPPDDPVILGGPVISLRAGDPLNLTCHADNAKPAAS
IIWLRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKET
SVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYR
TTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTG
NPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPP
IISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVI
STLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGV
AVGAGVAFLVLMATIVAFCCARSQRNLKGVVSAKNDIRVEIVHKEPASGREGEEHSTIKQ
LMMDRGEFQQDSVLKQLEVLKEEEKEFQNLKDPTNGYYSVNTFKEHHSTPTISLSSCQPD
LRPAGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSS
SFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV
Download sequence
Identical sequences Q8IZU9
ENSP00000435466 NYSGRC-IgSF-KIRR3_HUMAN NP_115920.1.87134 NP_115920.1.92137 XP_011541333.1.92137 XP_016873909.1.92137 gi|26006461|ref|NP_115920.1| ENSP00000435466 ENSP00000408692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]