SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N0U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8N0U2
Sequence length 210
Comment (sp|Q8N0U2|TMM61_HUMAN) Transmembrane protein 61 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TMEM61; OC=Catarrhini; Hominidae; Homo.
Sequence
MALPQMCDGSHLASTLRYCMTVSGTVVLVAGTLCFAWWSEGDATAQPGQLAPPTEYPVPE
GPSPLLRSVSFVCCGAGGLLLLIGLLWSVKASIPGPPRWDPYHLSRDLYYLTVESSEKES
CRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESI
SLALDAVSAETTPSATRSCSGLVQTARGGS
Download sequence
Identical sequences Q8N0U2
ENSP00000360315 gi|32698902|ref|NP_872338.1| NP_872338.1.87134 NP_872338.1.92137 XP_011539213.1.92137 ENSP00000360315 9606.ENSP00000360315 ENSP00000360315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]