SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N0V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8N0V5
Domain Number - Region: 5-90
Classification Level Classification E-value
Superfamily IVS-encoded protein-like 0.00249
Family IVS-encoded protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8N0V5
Sequence length 402
Comment (sp|Q8N0V5|GNT2A_HUMAN) IGNT KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GCNT2; OC=Catarrhini; Hominidae; Homo.
Sequence
MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYP
TENALKTTLDEATCYEYMVRSHYVTETLSEEEAGFPLAYTVTIHKDFGTFERLFRAIYMP
QNVYCVHLDQKATDAFKGAVKQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVAS
EVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHK
NSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHF
WVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNS
PSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Download sequence
Identical sequences Q8N0V5
ENSP00000368917 ENSP00000419411 ENSP00000314844 ENSP00000368917 ENSP00000419411 NP_663624.1.87134 NP_663624.1.92137 XP_006715115.1.92137 gi|21717810|ref|NP_663624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]