SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N0Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8N0Z2
Domain Number - Region: 221-272
Classification Level Classification E-value
Superfamily HP0062-like 0.0902
Family HP0062-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N0Z2
Sequence length 381
Comment (sp|Q8N0Z2|ABRA_HUMAN) Striated muscle activator of Rho-dependent signaling KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ABRA OC=Catarrhini; Hominidae; Homo.
Sequence
MAPGEKESGEGPAKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSP
QAPKPITPPTSHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKTVVSKTYER
GGDVSHLSHRYERDAGVLEPGQPENDIDRILHSHGSPTRRRKCANLVSELTKGWRVMEQE
EPTWRSDSVDTEDSGYGGEAEERPEQDGVQVAVVRIKRPLPSQVNRFTEKLNCKAQQKYS
PVGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK
RAEEHIYREMMDMCFIICTMARHRRDGKIQVTFGDLFDRYVRISDKVVGILMRARKHGLV
DFEGEMLWQGRDDHVVITLLK
Download sequence
Identical sequences Q8N0Z2
ENSP00000311436 gi|21040251|ref|NP_631905.1| ENSP00000311436 9606.ENSP00000311436 NP_631905.1.87134 NP_631905.1.92137 ENSP00000311436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]