SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N1B3 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8N1B3
Domain Number 1 Region: 19-136
Classification Level Classification E-value
Superfamily Cyclin-like 7.66e-30
Family Cyclin 0.0021
Further Details:      
 
Domain Number 2 Region: 139-244
Classification Level Classification E-value
Superfamily Cyclin-like 6.13e-27
Family Cyclin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Q8N1B3
Sequence length 248
Comment (sp|Q8N1B3|FA58A_HUMAN) Cyclin-M KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAM58A; OC=Catarrhini; Hominidae; Homo.
Sequence
MEAPEGGGGGPAARGPEGQPAPEARVHFRVARFIMEAGVKLGMRSIPIATACTIYHKFFC
ETNLDAYDPYLIAMSSIYLAGKVEEQHLRTRDIINVSNRYFNPSGEPLELDSRFWELRDS
IVQCELLMLRVLRFQVSFQHPHKYLLHYLVSLQNWLNRHSWQRTPVAVTAWALLRDSYHG
ALCLRFQAQHIAVAVLYLALQVYGVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQI
YTMDTEIP
Download sequence
Identical sequences K7DI08 Q8N1B3
ENSP00000464713 ENSP00000461135 ENSP00000461135 gi|196049382|ref|NP_689487.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]