SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N292 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N292
Sequence length 157
Comment (sp|Q8N292|GAPT_HUMAN) Growth factor receptor-bound protein 2-binding adapter protein, transmembrane KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GAPT; OC=Catarrhini; Hominidae; Homo.
Sequence
MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKT
FLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNF
EEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY
Download sequence
Identical sequences A0A024QZS2 Q8N292
ENSP00000323075 ENSP00000379997 gi|22749379|ref|NP_689900.1| ENSP00000323075 ENSP00000379997 ENSP00000379997 NP_001291357.1.87134 NP_001291357.1.92137 NP_001291358.1.87134 NP_001291358.1.92137 NP_001291360.1.87134 NP_001291360.1.92137 NP_689900.1.87134 NP_689900.1.92137 9606.ENSP00000323075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]