SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N2M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N2M4
Sequence length 240
Comment (sp|Q8N2M4|TM86A_HUMAN) Transmembrane protein 86A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TMEM86A; OC=Catarrhini; Hominidae; Homo.
Sequence
MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLG
FLLAHPSATRIFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRT
GLVMAALSGLCYALLYPCLSGAFTYLVGVYVALIGFMGWRAMAGLRLAGADWRWTELAAG
SGALFFIISDLTIALNKFCFPVPYSRALIMSTYYVAQMLVALSAVESREPVEHYRLTKAN
Download sequence
Identical sequences Q8N2M4
9606.ENSP00000280734 ENSP00000280734 ENSP00000280734 gi|23503275|ref|NP_699178.1| ENSP00000280734 NP_699178.1.87134 NP_699178.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]