SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N392 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8N392
Domain Number 1 Region: 318-523
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.28e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8N392
Sequence length 663
Comment (sp|Q8N392|RHG18_HUMAN) Rho-type GTPase-activating protein 18 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGAP18 OC=Catarrhini; Hominidae; Homo.
Sequence
MSWLSSSQGVVLTAYHPSGKDQTVGNSHAKAGEEATSSRRYGQYTMNQESTTIKVMEKPP
FDRSISQDSLDELSMEDYWIELENIKKSSENSQEDQEVVVVKEPDEGELEEEWLKEAGLS
NLFGESAGDPQESIVFLSTLTRTQAAAVQKRVETVSQTLRKKNKQYQIPDVRDIFAQQRE
SKETAPGGTESQSLRTNENKYQGRDDEASNLVGEEKLIPPEETPAPETDINLEVSFAEQA
LNQKESSKEKIQKSKGDDATLPSFRLPKDKTGTTRIGDLAPQDMKKVCHLALIELTALYD
VLGIELKQQKAVKIKTKDSGLFCVPLTALLEQDQRKVPGMRIPLIFQKLISRIEERGLET
EGLLRIPGAAIRIKNLCQELEAKFYEGTFNWESVKQHDAASLLKLFIRELPQPLLSVEYL
KAFQAVQNLPTKKQQLQALNLLVILLPDANRDTLKALLEFLQRVIDNKEKNKMTVMNVAM
VMAPNLFMCHALGLKSSEQREFVMAAGTANTMHLLIKYQKLLWTIPKFIVNQVRKQNTEN
HKKDKRAMKKLLKKMAYDREKYEKQDKSTNDADVPQGVIRVQAPHLSKVSMAIQLTEELK
ASDVLARFLSQESGVAQTLKKGEVFLYEIGGNIGERCLDDDTYMKDLYQLNPNAEWVIKS
KPL
Download sequence
Identical sequences Q8N392
ENSP00000357131 NP_277050.2.87134 NP_277050.2.92137 ENSP00000357131 9606.ENSP00000275189 gi|39932589|ref|NP_277050.2| ENSP00000357131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]