SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N3A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8N3A8
Domain Number 1 Region: 639-749,783-825
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.58e-29
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N3A8
Sequence length 854
Comment (sp|Q8N3A8|PARP8_HUMAN) ADP-ribosyltransferase diphtheria toxin-like 16 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PARP8; OC=Catarrhini; Hominidae; Homo.
Sequence
MGMCSRQERIQKDIDVVIQKSRAEKDCLFADFRYSDSTFTFTYVGGPRSVSYSVHVSEDY
PDNTYVSSSENDEDVLVTTEPIPVIFHRIATELRKTNDINCCLSIKSKLQKENGEESRQN
STVEEDSEGDNDSEEFYYGGQVNYDGELHKHPQLEADLSAVREIYGPHAVSLREYGAIDD
VDIDLHIDVSFLDEEIAVAWEVIRTEPIIVRLHCSLTQYLNGPVPTVDVFQISTKERFGL
GHQLKKIMQTFVTQQWKQSKEKSNCLHNKKLSEKKVKSPLHLFSTLRRSPSYPPPGCGKS
KSKLKSEQDGISKTHKLLRRTCSSTVKTDDVCVTKSHRTFGRSLSSDPRAEQAMTAIKSH
KLLNRPCPAAVKSEECLTLKSHRLLTRSCSGDPRCEHNTNLKPHKLLSRSYSSNLRMEEL
YGLKNHKLLSKSYSSAPKSSKTELFKEPNAEGRRLSLTSGLIGILTPSSSSSSQLAPNGA
KCIPVRDRGFLVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQT
LGVMNEAADEIATGAQVVDLLVSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKK
NYDRVMKALDSITSIREMTQAPYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQ
LKFMHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTRL
QLHGAMYGSGIYLSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSNTSQSQKKGQQSQFL
QSRNLKCIALCEVITSSDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIH
KEILRVIGNQTATG
Download sequence
Identical sequences Q8N3A8
gi|24432009|ref|NP_078891.2| gi|295844829|ref|NP_001171526.1| ENSP00000281631 ENSP00000422217 ENSP00000422288 9606.ENSP00000281631 NP_001171526.1.87134 NP_001171526.1.92137 NP_078891.2.87134 NP_078891.2.92137 XP_011541933.1.92137 ENSP00000281631 ENSP00000422217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]