SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N966 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8N966
Sequence length 263
Comment (sp|Q8N966|ZDH22_HUMAN) Zinc finger DHHC domain-containing protein 22 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZDHHC22; OC=Catarrhini; Hominidae; Homo.
Sequence
MLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPAAARLFSPALLHGALFLFLSAN
ALGNYVLVIQNSPDDLGACQGASARKTPCPSPSTHFCRVCARVTLRHDHHCFFTGNCIGS
RNMRNFVLFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLG
SEMFVILMLYLWFAIGLACAGFCCHQLLLILRGQTRHQVRKGVAVRARPWRKNLQEVFGK
RWLLGLLVPMFNVGSESSKQQDK
Download sequence
Identical sequences A0A2J8W5W2 G1S3X2 G3R3R5 H2RG61 Q8N966
NP_777636.2.87134 NP_777636.2.92137 XP_001163688.1.37143 XP_003260843.1.23891 XP_003808910.1.60992 XP_006720182.1.92137 XP_008959215.1.60992 XP_008959216.1.60992 XP_009426468.1.37143 XP_011534963.1.92137 XP_012353575.1.23891 XP_014203136.1.60992 XP_014203137.1.60992 XP_016781980.1.37143 XP_018865394.1.27298 XP_018865395.1.27298 ENSP00000318222 ENSP00000318222 ENSNLEP00000020210 ENSPTRP00000060507 ENSNLEP00000020210 gi|145046234|ref|NP_777636.2| ENSPTRP00000060507 ENSP00000318222 9606.ENSP00000318222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]