SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N9N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N9N5
Sequence length 519
Comment (sp|Q8N9N5|BANP_HUMAN) Scaffold/matrix-associated region-1-binding protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BANP; OC=Catarrhini; Hominidae; Homo.
Sequence
MMSEHDLADVVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKTICLRL
DSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTV
ILNNDRQNAIVAKMEDPLSNRAPDSLENVISNAVPGRRQNTIVVKVPGQEDSHHEDGESG
SEASDSVSSCGQAGSQSIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLH
ISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGIT
ESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPNSSSYCPSEPMMSTPPPASELP
QPQPQPQALHYALANAQQVQIHQIGEDGQVQVGHLHIAQVPQGEQVQITQDSEGNLQIHH
VGQDGQLLEATRIPCLLAPSVFKASSGQVLQGAQLIAVASSDPAAAGVDGSPLQGSDIQV
QYVQLAPVSDHTAGAQTAEALQPTLQPEMQLEHGAIQIQ
Download sequence
Identical sequences A0A2K5JR56 A0A2K5X151 A0A2K6C1S9 A0A2K6LCC5 A0A2K6NAZ4 G7NPH4 Q8N9N5
ENSP00000286122 ENSP00000376902 NP_001167014.1.87134 NP_001167014.1.92137 ENSP00000286122 ENSP00000376902 ENSP00000401718 gi|291084803|ref|NP_001167014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]