SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8ND76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8ND76
Domain Number 1 Region: 167-265
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000605
Family Cyclin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8ND76
Sequence length 341
Comment (sp|Q8ND76|CCNY_HUMAN) cyclin-X KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CCNY; OC=Catarrhini; Hominidae; Homo.
Sequence
MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPS
DHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTI
KCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFS
AAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQI
LKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAH
KLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS
Download sequence
Identical sequences A0A0D9RG18 A0A2I2YSM3 A0A2K5EIZ2 A0A2K5LH11 A0A2K5TS85 A0A2K5XFW4 A0A2K6CZK2 A0A2K6MHU8 H2NA60 I0FLH7 K7BZJ5 Q8ND76 U3BLC8
ENSP00000363836 ENSMMUP00000008832 NP_001244419.1.72884 NP_659449.3.87134 NP_659449.3.92137 XP_003814825.1.60992 XP_004049319.1.27298 XP_005565048.1.63531 XP_008001014.1.81039 XP_011764183.1.29376 XP_011850529.1.47321 XP_011940092.1.92194 XP_012301045.1.9421 XP_016818511.1.37143 XP_017703884.1.44346 ENSGGOP00000004320 ENSMMUP00000008832 ENSPPYP00000002569 gi|32171247|ref|NP_659449.3| ENSPPYP00000002569 ENSGGOP00000004320 9544.ENSMMUP00000008832 9600.ENSPPYP00000002569 9606.ENSP00000363836 ENSP00000344275 ENSP00000363836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]