SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NDY4 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8NDY4
Sequence length 140
Comment (sp|Q8NDY4|MDS2_HUMAN) Myelodysplastic syndrome 2 translocation-associated protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MDS2; OC=Catarrhini; Hominidae; Homo.
Sequence
MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMR
GGARGRPQLTLERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPCEDPARGWLSANPGREP
SPGICWHLNLGLPSLHNCEE
Download sequence
Identical sequences A0A024RAF8 Q8NDY4
ENSP00000363683 ENSP00000363683 ENSP00000363683 9606.ENSP00000363683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]