SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NDY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8NDY6
Domain Number 1 Region: 99-172
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.81e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8NDY6
Sequence length 225
Comment (sp|Q8NDY6|BHE23_HUMAN) Class B basic helix-loop-helix protein 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BHLHE23; OC=Catarrhini; Hominidae; Homo.
Sequence
MAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPAQ
AAESSGEQSGDEDDAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERRRMHDLNDAL
DGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNA
APLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP
Download sequence
Identical sequences A0A2J8KN03 Q8NDY6
ENSP00000359371 ENSPTRP00000023636 ENSP00000359371 9598.ENSPTRP00000023636 9606.ENSP00000359371 gi|57529222|ref|NP_542173.1| ENSPTRP00000023636 ENSP00000359371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]