SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NEY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8NEY8
Sequence length 458
Comment (sp|Q8NEY8|PPHLN_HUMAN) Gastric cancer antigen Ga50 {ECO:0000303|PubMed:12087473} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PPHLN1 OC=Catarrhini; Hominidae; Homo.
Sequence
MWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDRPGEGSYNRYYSHVDYRD
YDEGRSFSHDRRSGPPHRGDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYARER
SPYKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYK
RQNEGNPERDKERPVQSLKTSRDTSPSSGSAVSSSKVLDKPSRLTEKELAEAASKWAAEK
LEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKE
IEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIESAGQTWQQVPPVRNTEMD
HDGTPENEGEETAQSAPQPPQAPQPLQPRKKRVRRTTQLRRTTGAPDITWGMLKKTTQEA
ERILLRTQTPFTPENLFLAMLSVVHCNSRKDVKPENKQ
Download sequence
Identical sequences Q8NEY8
gi|48255929|ref|NP_057572.5| ENSP00000378935 ENSP00000479913 ENSP00000322048 9606.ENSP00000338510 ENSP00000378935 HR4781 NP_057572.5.87134 NP_057572.5.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]