SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NFM4 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8NFM4
Domain Number 1 Region: 867-1062
Classification Level Classification E-value
Superfamily Nucleotide cyclase 9.58e-58
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000000322
Further Details:      
 
Domain Number 2 Region: 260-428
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.02e-56
Family Adenylyl and guanylyl cyclase catalytic domain 0.000000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytosol 1.295 67.62
cilium 1.675 14.45
actin-based cell projection 1.622 4.26
microvillus 2.247 4.26

Protein sequence

External link(s) Q8NFM4
Sequence length 1077
Comment (sp|Q8NFM4|ADCY4_HUMAN) Adenylyl cyclase 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ADCY4; OC=Catarrhini; Hominidae; Homo.
Sequence
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
Download sequence
Identical sequences Q8NFM4
ENSP00000312126 ENSP00000393177 ENSP00000452250 gi|24497587|ref|NP_640340.2| gi|310832384|ref|NP_001185521.1| gi|310832386|ref|NP_001185497.1| 9606.ENSP00000312126 ENSP00000312126 ENSP00000312126 ENSP00000393177 ENSP00000452250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]