SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NFP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8NFP0
Domain Number - Region: 71-98
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.000187
Family Bcl-2 inhibitors of programmed cell death 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8NFP0
Sequence length 134
Comment (sp|Q8NFP0|PXT1_HUMAN) Small testis-specific peroxisomal protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PXT1; OC=Catarrhini; Hominidae; Homo.
Sequence
MKKKHDGIVYETKEVLNPSPKVTHCCKSLWLKYSFQKAYMTQLVSSQPVPAMSRNPDHNL
LSQPKEHSIVQKHHQEEIIHKLAMQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRR
VQVLLHFFWNNHLL
Download sequence
Identical sequences Q8NFP0
ENSP00000419944 9606.ENSP00000419944 NP_694535.2.87134 NP_694535.2.92137 gi|259013562|ref|NP_694535.2| ENSP00000419944 ENSP00000419944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]